PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040252.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 491aa    MW: 53169.2 Da    PI: 6.9514
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040252.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.13.6e-084789541
     zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                  C+++++++++  C++ ++ lC++C   +H+       H++++
  Pbr040252.1 47 LCERCNSQPASVRCTEERVSLCQNCDWMGHQAstsasgHKRQT 89
                 7*****************************7788888898765 PP

2CCT56.69.3e-20356398143
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                  R++a++RYkeK+k RkFeK++rY+sRKa+A+ R+RvKGrF k+
  Pbr040252.1 356 RNNAVMRYKEKKKARKFEKRVRYASRKARADVRKRVKGRFIKA 398
                  99**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501198.617147IPR000315B-box-type zinc finger
SMARTSM003365.9E-5447IPR000315B-box-type zinc finger
CDDcd000213.71E-4435No hitNo description
PROSITE profilePS501199.2574390IPR000315B-box-type zinc finger
PfamPF006434.2E-54789IPR000315B-box-type zinc finger
CDDcd000211.06E-54790No hitNo description
SMARTSM003360.144890IPR000315B-box-type zinc finger
PfamPF062032.6E-15356398IPR010402CCT domain
PROSITE profilePS5101715.289356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MGYLCDYCQV QRSMVHCRSD AACLCLSCDR NVHSANALSR RHLRTLLCER CNSQPASVRC  60
TEERVSLCQN CDWMGHQAST SASGHKRQTL NCYSGCPSSA ELSSIWSFVS DLPFNGESTC  120
EQEMGLMSIA DNGTRSDWSQ TESNTRQSAS GADEVNAAHS MEKSGILVGS SSVPERSHAR  180
HVVGQLTGSV NASLPKLYSH GGKGTGLPED DDLYDDLDMD EMELNLENYE ELFGVSLNHS  240
EELFKNGGID SLFGAKNVSR DCQDAVAAEG SSIGLGNAPQ PACSNAASAD SVMSTKTDPV  300
ICFPAKQAHS NLSFSGVTGE SSAGDCQDCG ASSKLLMGEP PWCHPCPESS MQSANRNNAV  360
MRYKEKKKAR KFEKRVRYAS RKARADVRKR VKGRFIKAVK SCMIVSQGLG FIEREGLMQT  420
ASVRFPFMFL WPKFICSIIL PGGFTLVFQT ITMLDALIIP VIIFCPPAPM TPIKSGCHGV  480
FAAELVVSGH *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361520.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9 isoform X1
SwissprotQ9SSE51e-147COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLD9ZIX50.0D9ZIX5_MALDO; COL domain class transcription factor
STRINGGLYMA20G07051.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43623353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-105B-box type zinc finger protein with CCT domain